Nocistatin(human)

Cat. No.: HY-P1020: FAQs
Data Sheet Handling Instructions

Molarity Calculator

Nocistatin (human) blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E₂.

For research use only. We do not sell to patients.

Nocistatin(human) Chemical Structure

CAS No. : 212609-11-5

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Nocistatin(human):

Nocistatin(human) TFA Get quote

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description	Nocistatin (human) blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E₂^[1].
In Vitro	Nocistatin (5.0 nmol) significantly improves the nociception (5.0 nmol)-induced impairment of learning and memory without changing motor activity or response to electric shocks^[2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Nocistatin(human) Related Antibodies
Molecular Weight	3561.93
Formula	C₁₄₉H₂₃₈N₄₂O₅₃S₃
CAS No.	212609-11-5
Sequence	Met-Pro-Arg-Val-Arg-Ser-Leu-Phe-Gln-Glu-Gln-Glu-Glu-Pro-Glu-Pro-Gly-Met-Glu-Glu-Ala-Gly-Glu-Met-Glu-Gln-Lys-Gln-Leu-Gln
Sequence Shortening	MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ
SMILES	[MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ]
Shipping	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation	Data Sheet (258 KB) Handling Instructions (2659 KB)
References	[1]. E Okuda-Ashitaka, et al. Nocistatin, a peptide that blocks nociceptin action in pain transmission. Nature. 1998 Mar 19;392(6673):286-9. [Content Brief] [2]. M Hiramatsu, et al. Effects of nocistatin on nociceptin-induced impairment of learning and memory in mice. Eur J Pharmacol. 1999 Feb 19;367(2-3):151-5. [Content Brief]

Nocistatin(human) Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Nocistatin(human)212609-11-5OthersInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Product Name			Lot #
Applicant Name *			Email Address *
Phone Number			Department *
Organization Name *			Country or Region *
Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.

Nocistatin(human)

Other Forms of Nocistatin(human):

Nocistatin(human) Related Antibodies

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

Biological Activity

Purity & Documentation

References

Customer Review