UDP-glucose 4-epimerase/GALE Protein, Human (His)

GALE proteins catalyze the reversible epimerization of UDP-glucose to UDP-galactose, and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. UDP-glucose 4-epimerase/GALE Protein, Human (His) is the recombinant human-derived UDP-glucose 4-epimerase/GALE protein, expressed by E. coli , with N-6*His labeled tag. The total length of UDP-glucose 4-epimerase/GALE Protein, Human (His) is 348 a.a., with molecular weight of ~38.23 kDa.

UDP-glucose 4-epimerase (GALE) protein orchestrates two distinct yet analogous reactions: the reversible epimerization of UDP-glucose to UDP-galactose and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The conversion of UDP-glucose to UDP-galactose is crucial in the Leloir pathway of galactose catabolism, directing galactose into the glycolytic intermediate glucose 6-phosphate. GALE's role is pivotal in the breakdown of dietary galactose and facilitates the endogenous biosynthesis of UDP-Gal and UDP-GalNAc when external sources are limited. These UDP-sugar interconversions are integral to the intricate processes involved in the synthesis of glycoproteins and glycolipids, underscoring the significance of GALE in cellular glycan biosynthesis.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

Q14376 (M1-A348)

2582  [NCBI]

MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA

Approximately 38.23 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 2 mM DTT, 1 mM EDTA, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.