UBE2J2 Protein, Human (GST)

N-GST;Accession#Q8N2K1-1 UBE2J2 (E124-R224)

UBE2J2, or ubiquitin-conjugating enzyme E2 J2, is a protein that plays a central role in the covalent attachment of ubiquitin to other proteins, a process critical for the regulation of protein stability and degradation. UBE2J2 is suggested to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD), indicating its involvement in cellular quality control mechanisms. Additionally, in cooperation with the GATOR2 complex, UBE2J2 catalyzes 'Lys-6'-linked ubiquitination of NPRL2, suggesting its participation in the regulation of cellular processes through ubiquitin modification. It has to highlight UBE2J2's dual role in ERAD and the ubiquitination of specific targets, illustrating its versatility in participating in diverse cellular pathways.

Human

E. coli

N-GST

Q8N2K1-1 (E124-R224)

118424  [NCBI]

EKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANR

30&36 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.