1. Recombinant Proteins
  2. Others
  3. TAFA4 Protein, Human (His)

TAFA4 Protein, Human (His)

Cat. No.: HY-P71350
COA Handling Instructions

TAFA4 protein, a modulator of injury-induced and chemical pain hypersensitivity, influences pain responses. It serves as a ligand for FPR1, chemoattracting macrophages, enhancing phagocytosis, and elevating reactive oxygen species (ROS) release. TAFA4's multifaceted role indicates involvement in immune responses and cellular processes related to inflammation and injury. TAFA4 Protein, Human (His) is the recombinant human-derived TAFA4 protein, expressed by E. coli , with N-6*His labeled tag. The total length of TAFA4 Protein, Human (His) is 106 a.a., with molecular weight of ~16.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $110 In-stock
50 μg $300 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TAFA4 protein, a modulator of injury-induced and chemical pain hypersensitivity, influences pain responses. It serves as a ligand for FPR1, chemoattracting macrophages, enhancing phagocytosis, and elevating reactive oxygen species (ROS) release. TAFA4's multifaceted role indicates involvement in immune responses and cellular processes related to inflammation and injury. TAFA4 Protein, Human (His) is the recombinant human-derived TAFA4 protein, expressed by E. coli , with N-6*His labeled tag. The total length of TAFA4 Protein, Human (His) is 106 a.a., with molecular weight of ~16.0 kDa.

Background

TAFA4 protein serves as a modulator of injury-induced and chemical pain hypersensitivity, potentially influencing pain responses. Acting as a ligand for FPR1, TAFA4 demonstrates the capacity to chemoattract macrophages, enhance phagocytosis, and elevate reactive oxygen species (ROS) release. This multifaceted role suggests its involvement in immune responses and cellular processes associated with inflammation and injury.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q96LR4 (S35-R140)

Gene ID
Molecular Construction
N-term
6*His
TAFA4 (S35-R140)
Accession # Q96LR4
C-term
Synonyms
Protein FAM19A4; Chemokine-like protein TAFA-4; TAFA4; family with sequence similarity 19 (chemokine (C-C motif)-like); member A4; FAM19A4; chemokine-like protein TAFA-4
AA Sequence

SSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TAFA4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TAFA4 Protein, Human (His)
Cat. No.:
HY-P71350
Quantity:
MCE Japan Authorized Agent: