1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. SCF Protein, Rat (HEK293, His)

SCF Protein, Rat (HEK293, His)

Cat. No.: HY-P71130
COA Handling Instructions

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $170 In-stock
50 μg $510 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Stem cell factor (SCF), as a key ligand of KIT, regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Binding to KIT activates signaling pathways involving phosphorylation events, key kinases (AKT1, RAS, RAF1, MAPK1/ERK2, MAPK3/ERK1), STAT family members, and PLCG1. SCF Protein, Rat (HEK293, His) is the recombinant rat-derived SCF protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Stem Cell Factor (SCF) operates as a pivotal ligand for the receptor-type protein-tyrosine kinase KIT, exerting indispensable regulatory functions in cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis. Upon binding to KIT, SCF activates diverse signaling pathways, triggering phosphorylation events that lead to the activation of key kinases such as AKT1 and components of the MAP kinase cascade, including RAS, RAF1, and MAPK1/ERK2 or MAPK3/ERK1. Furthermore, SCF-driven signaling involves the activation of STAT family members (STAT1, STAT3, and STAT5) and PLCG1, culminating in the production of crucial cellular signaling molecules. Operating synergistically with other cytokines, likely interleukins, SCF forms homodimers and non-covalently links to KIT, resulting in the formation of a heterotetramer that mediates KIT dimerization and subsequent activation through autophosphorylation. This intricate network underscores SCF's multifaceted role in orchestrating diverse cellular processes and developmental pathways.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

P21581-1 (Q26-A189)

Gene ID

60427  [NCBI]

Molecular Construction
N-term
SCF (Q26-A189)
Accession # P21581-1
6*His
C-term
Synonyms
FPH2; KIT ligand; Kitl; KITLG; KL-1; Mast cell growth factor; MGF; MGFSHEP7; SCF; SCFStem cell factor; SFc-Kit ligand; SLF; steel factor
AA Sequence

QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Weight

23-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SCF Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SCF Protein, Rat (HEK293, His)
Cat. No.:
HY-P71130
Quantity:
MCE Japan Authorized Agent: