1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Noggin Protein, Human (CHO)

Noggin Protein, Human (CHO)

Cat. No.: HY-P7051A
COA Handling Instructions

Noggin Protein, Human (CHO) is an antagonist of bone morphogenetic proteins (BMPs), binds with high affinity to hBMP-4, and with lower affinity to hBMP-7; Noggin Protein is essential for proper skeletal development.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $120 In-stock
50 μg $460 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Noggin Protein, Human (CHO) is an antagonist of bone morphogenetic proteins (BMPs), binds with high affinity to hBMP-4, and with lower affinity to hBMP-7; Noggin Protein is essential for proper skeletal development.

Background

Human Noggin protein has 205 amino acids (residues 28-232) after removal of its signal sequence (residues 1-27) and is secreted as a glycosylated, covalently linked homodimer, binds with high affinity to hBMP-4, and with lower affinity to hBMP-7 and acts as an antagonist of bone morphogenetic proteins (BMPs)[1]. Noggin is essential for proper skeletal development; excess BMP activity in the Noggin null mutant results in excess cartilage and failure to initiate joint formation[2].

Biological Activity

1.ED50 < 2.5 ng/mL, measured in a bioassay using ATDC5 cells in the presence of 10 ng/mL human BMP-4. 2.Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.002519 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP-4 (HY-P7007), corresponding to a specific activity is 3.970×105 units/mg.

  • Measured by its ability to inhbit BMP-4-induced alkalnephosphatase production by ATDC5 mouse chondrogenic cells in the presence of Recombinant Human BMP-4 (40 ng/mL), with an ED50 of 4 ng/mL.
Species

Human

Source

CHO

Tag

Tag Free

Accession

Q13253 (Q28-C232)

Gene ID
Molecular Construction
N-term
Noggin (Q28-C232)
Accession # Q13253
C-term
Synonyms
rHuNoggin; NOG
AA Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Weight

Approximately 25-31 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Noggin Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Noggin Protein, Human (CHO)
Cat. No.:
HY-P7051A
Quantity:
MCE Japan Authorized Agent: