1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. Natural Killer Group 2, Member D (NKG2D) T Cell CD Proteins NK Cell CD Proteins
  4. CD314/NKG2D
  5. NKG2D/CD314 Protein, Cynomolgus (HEK293, His)

NKG2D/CD314 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P72504
COA Instruction de manipulation

The NKG2D/CD314 protein serves as an important activating and costimulatory receptor in immune surveillance. It binds to stress-inducing ligands on tumor and virus-infected cells, activates NK cells and serves as a costimulatory receptor for CD8(+) T cell-mediated adaptive responses, thereby enhancing T cell activation. NKG2D/CD314 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived NKG2D/CD314 protein, expressed by HEK293 , with N-6*His labeled tag. The total length of NKG2D/CD314 Protein, Cynomolgus (HEK293, His) is 139 a.a., with molecular weight of 22-35 kDa.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Protein Expression Service

Size Prix Stock Quantité
10 μg $125 En stock
50 μg $350 En stock
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

The NKG2D/CD314 protein serves as an important activating and costimulatory receptor in immune surveillance. It binds to stress-inducing ligands on tumor and virus-infected cells, activates NK cells and serves as a costimulatory receptor for CD8(+) T cell-mediated adaptive responses, thereby enhancing T cell activation. NKG2D/CD314 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived NKG2D/CD314 protein, expressed by HEK293 , with N-6*His labeled tag. The total length of NKG2D/CD314 Protein, Cynomolgus (HEK293, His) is 139 a.a., with molecular weight of 22-35 kDa.

Background

NKG2D/CD314 protein operates as an activating and costimulatory receptor crucial for immunosurveillance, binding to diverse stress-inducible ligands presented on autologous tumor cells and virus-infected cells. It plays a dual role in innate immune responses, stimulating both activating killer (NK) cells and acting as a costimulatory receptor for T-cell receptors (TCR) in CD8(+) T-cell-mediated adaptive immune responses, enhancing T-cell activation. The receptor facilitates perforin-mediated elimination of ligand-expressing tumor cells and triggers signaling cascades involving calcium influx, ultimately leading to TNF-alpha expression. Additionally, NKG2D/CD314 participates in NK cell-mediated bone marrow graft rejection and may regulate the differentiation and survival of NK cells. Its ligand-binding capacity extends to various subfamilies of MHC class I-related glycoproteins. The protein forms homodimers through disulfide linkage and heterohexamers with HCST/DAP10 subunits, a crucial interaction for NK cell surface expression and cytotoxicity induction. Furthermore, it can establish disulfide-bonded heterodimers with CD94 and interacts with CEACAM1, recruiting PTPN6 for VAV1 dephosphorylation.

Species

Cynomolgus

Source

HEK293

Tag

N-6*His

Accession

P61252 (F78-V216)

Gene ID

102120479  [NCBI]

Molecular Construction
N-term
6*His
NKG2D (F78-V216)
Accession # P61252
C-term
Synonyms
NKG2-D type II integral membrane protein; CD314; KLRK1; NKG2-D
AA Sequence

FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFNESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSIPNTYICMQRTV

Masse moléculaire

22-35 kDa

Pureté

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

Nom du produit

 

Salutation

Nom du demandeur *

 

Adresse électronique *

Numéro de téléphone *

 

Nom de l'organisation *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Nom du produit:
NKG2D/CD314 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P72504
Quantité:
MCE Japan Authorized Agent: