1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Neurotrimin Protein, Human (283a.a, HEK293, His)

Neurotrimin Protein, Human (283a.a, HEK293, His)

Cat. No.: HY-P71154
Handling Instructions

Neurotrimin Protein, a neural cell adhesion molecule, plays a crucial role in facilitating neural connections through its adhesive properties. As a member of the cell adhesion molecule family, Neurotrimin influences various aspects of neural function, including cell adhesion, communication, and potential contributions to neuronal development and synaptic plasticity, underscoring its significance as a molecular mediator within the nervous system. Neurotrimin Protein, Human (283a.a, HEK293, His) is the recombinant human-derived Neurotrimin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Neurotrimin Protein, Human (283a.a, HEK293, His) is 283 a.a., with molecular weight of ~51-60 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Neurotrimin Protein, Human (283a.a, HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Neurotrimin Protein, a neural cell adhesion molecule, plays a crucial role in facilitating neural connections through its adhesive properties. As a member of the cell adhesion molecule family, Neurotrimin influences various aspects of neural function, including cell adhesion, communication, and potential contributions to neuronal development and synaptic plasticity, underscoring its significance as a molecular mediator within the nervous system. Neurotrimin Protein, Human (283a.a, HEK293, His) is the recombinant human-derived Neurotrimin protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Neurotrimin Protein, Human (283a.a, HEK293, His) is 283 a.a., with molecular weight of ~51-60 kDa.

Background

Neurotrimin, a neural cell adhesion molecule, serves as a crucial player in cellular interactions within the nervous system. As a member of the cell adhesion molecule family, Neurotrimin is implicated in facilitating neural connections through its adhesive properties. The protein's role encompasses various aspects of neural function, including cell adhesion, communication, and potentially influencing processes such as neuronal development and synaptic plasticity. Neurotrimin's involvement highlights its significance as a molecular mediator in the intricate network of interactions within the nervous system.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9P121-3 (G34-L316)

Gene ID
Molecular Construction
N-term
Neurotrimin (G34-L316)
Accession # Q9P121-3
6*His
C-term
Synonyms
Neurotrimin; NTM; IgLON family member 2; IGLON2; HNT; NTRI;
AA Sequence

GDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFGETVL

Molecular Weight

51-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Neurotrimin Protein, Human (283a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neurotrimin Protein, Human (283a.a, HEK293, His)
Cat. No.:
HY-P71154
Quantity:
MCE Japan Authorized Agent: