1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. Multi-CSF/IL-3
  5. IL-3 Protein, Human (His)

IL-3 Protein, Human (His)

Cat. No.: HY-P70576
COA Instruction de manipulation

IL-3 protein is mainly secreted by T lymphocytes, mast cells and osteoblasts and is critical for the generation and differentiation of hematopoietic progenitor cells. It stimulates mature basophils, eosinophils and monocytes, promoting functional activation. IL-3 Protein, Human (His) is the recombinant human-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of IL-3 Protein, Human (His) is 133 a.a., with molecular weight of 13-16 kDa.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Protein Expression Service

Size Prix Stock Quantité
10 μg $125 En stock
50 μg $350 En stock
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products

Publications Citing Use of MCE IL-3 Protein, Human (His)

  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

IL-3 protein is mainly secreted by T lymphocytes, mast cells and osteoblasts and is critical for the generation and differentiation of hematopoietic progenitor cells. It stimulates mature basophils, eosinophils and monocytes, promoting functional activation. IL-3 Protein, Human (His) is the recombinant human-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of IL-3 Protein, Human (His) is 133 a.a., with molecular weight of 13-16 kDa.

Background

The cytokine IL-3, predominantly secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, plays a crucial role in controlling the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Additionally, IL-3 stimulates mature basophils, eosinophils, and monocytes, promoting their functional activation. Beyond its hematopoietic functions, IL-3 contributes to neural cell proliferation and survival. Moreover, it participates in bone homeostasis by inhibiting osteoclast differentiation through the prevention of NF-kappa-B nuclear translocation and activation. Mechanistically, IL-3 exerts its biological effects through a receptor composed of the IL3RA subunit and the signal transducing subunit IL3RB. Stimulation of this receptor leads to the rapid activation of JAK2 kinase activity, initiating a STAT5-mediated transcriptional program. Alternatively, IL-3 contributes to cell survival under oxidative stress in non-hematopoietic systems by activating pathways mediated by PI3K/AKT and ERK. The cytokine also interacts with IL3RA to modulate its diverse physiological effects.

Activité biologique

1.The cell proliferation assay using TF-1 human erythroleukemic cells has an ED50 value of 0.05-0.3 ng/mL.
2.Loaded Human IL-3RA-Fc on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.89 uM as determined in BLI assay.
3.Loaded Human IL-3RA-Fc-Avi on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.74 uM as determined in BLI assay.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P08700 (A20-F152)

Gene ID
Molecular Construction
N-term
6*His
IL-3 (A20-F152)
Accession # P08700
C-term
Synonyms
Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3
AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Masse moléculaire

13-16 kDa

Pureté

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Documentation

IL-3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

Nom du produit

 

Salutation

Nom du demandeur *

 

Adresse électronique *

Numéro de téléphone *

 

Nom de l'organisation *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Nom du produit:
IL-3 Protein, Human (His)
Cat. No.:
HY-P70576
Quantité:
MCE Japan Authorized Agent: