1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FAM3B Protein, Human (206a.a, HEK293, Fc)

FAM3B Protein, Human (206a.a, HEK293, Fc)

Cat. No.: HY-P70386
COA Handling Instructions

FAM3B Protein acts as a potent inducer of apoptosis, influencing alpha and beta cells in a dose- and time-dependent manner. Its regulatory impact on programmed cell death underscores its significance, particularly within apoptosis. The specificity for alpha and beta cells suggests targeted modulation of pancreatic cell populations, implicating FAM3B in key processes related to pancreatic function and homeostasis. FAM3B Protein, Human (206a.a, HEK293, Fc) is the recombinant human-derived FAM3B protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $65 In-stock
50 μg $185 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FAM3B Protein acts as a potent inducer of apoptosis, influencing alpha and beta cells in a dose- and time-dependent manner. Its regulatory impact on programmed cell death underscores its significance, particularly within apoptosis. The specificity for alpha and beta cells suggests targeted modulation of pancreatic cell populations, implicating FAM3B in key processes related to pancreatic function and homeostasis. FAM3B Protein, Human (206a.a, HEK293, Fc) is the recombinant human-derived FAM3B protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The FAM3B protein serves as a potent inducer of apoptosis, acting on both alpha and beta cells in a dose- and time-dependent manner. Its regulatory influence on programmed cell death highlights its significance in shaping cellular responses, particularly within the context of apoptosis. The specificity of this effect on alpha and beta cells suggests a targeted impact on pancreatic cell populations, potentially implicating FAM3B in the modulation of key processes related to pancreatic function and homeostasis.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P58499-1 (E30-S235)

Gene ID
Molecular Construction
N-term
FAM3B (E30-S235)
Accession # P58499-1
hFc
C-term
Synonyms
Protein FAM3B; PANDER; C21orf11; C21orf76; PRED44
AA Sequence

ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS

Molecular Weight

50-65 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

FAM3B Protein, Human (206a.a, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FAM3B Protein, Human (206a.a, HEK293, Fc)
Cat. No.:
HY-P70386
Quantity:
MCE Japan Authorized Agent: