1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T Related Proteins CD Antigens
  3. TNF Superfamily T Cell CD Proteins Macrophage CD Proteins Erythrocyte CD Proteins
  4. TNF Receptor Superfamily CD30
  5. CD30/TNFRSF8 Protein, Cynomolgus (HEK293, His)

CD30/TNFRSF8 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P76792
Handling Instructions

CD30/TNFRSF8 Protein exhibits an absence of conserved residue(s) crucial for the propagation of feature annotation. CD30/TNFRSF8 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD30/TNFRSF8 Protein, Cynomolgus (HEK293, His) is 194 a.a., with molecular weight of 33-55 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD30/TNFRSF8 Protein exhibits an absence of conserved residue(s) crucial for the propagation of feature annotation. CD30/TNFRSF8 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD30/TNFRSF8 Protein, Cynomolgus (HEK293, His) is 194 a.a., with molecular weight of 33-55 kDa.

Background

The CD30/TNFRSF8 protein is marked by an absence of conserved residue(s) necessary for the propagation of feature annotation.

Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

XP_015298065 (M1-G194)

Gene ID

102137811  [NCBI]

Molecular Construction
N-term
CD30 (M1-G194)
Accession # XP_015298065
His
C-term
Synonyms
CD30L receptor; Tumor necrosis factor receptor superfamily member 8; Ki-1 antigen
AA Sequence

MPLRGGTRLAQEAASKLTRAPGSPSSVGRPSSDPGLSPTQPCPQGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRICECRPGMICATSATNSCARCVPYPICAAETGTKPQDMAEKDTTFEAPPVGTQPDCSPTPENGEAPASTSPTLSSLVDSQASKTLPIPTSAPIALSSTGKPVLDAG

Molecular Weight

Approximately 33-55 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD30/TNFRSF8 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P76792
Quantity:
MCE Japan Authorized Agent: