Animal-Free FGF-11 isoform 1 Protein, Human (His)

The FGF-11 isoform 1 protein is thought to play an important role in the development and function of the nervous system. Its presence indicates involvement in complex processes responsible for establishing and maintaining neural structure and activity. Animal-Free FGF-11 isoform 1 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-11 isoform 1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free FGF-11 isoform 1 Protein, Human (His) is 225 a.a., with molecular weight of ~25.81 kDa.

FGF-11 isoform 1 Protein is believed to play a significant role in the development and functioning of the nervous system. Its presence suggests involvement in the intricate processes responsible for establishing and maintaining neural structures and activities. As a member of the fibroblast growth factor (FGF) family, this isoform likely contributes to neural growth, differentiation, and communication. Although further research is required to fully comprehend the precise mechanisms and functions of FGF-11 isoform 1 Protein, its potential importance in neural development highlights its significance as a key player in the intricate orchestration of the nervous system.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <0.2 ng/mL.

Human

E. coli

C-His

Q92914 (M1-P225)

2256  [NCBI]

MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP

Approximately 25.81 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

<0.01 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.