1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Angiopoietins
  4. ANG-2
  5. Angiopoietin-2 Protein, Human (HEK293, His)

Angiopoietin-2 Protein, Human (HEK293, His)

Cat. No.: HY-P72829
COA Handling Instructions

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (HEK293, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by HEK293 , with C-His labeled tag. The total length of Angiopoietin-2 Protein, Human (HEK293, His) is 478 a.a., with molecular weight of ~63.5 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
50 μg $350 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Angiopoietin-2 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (HEK293, His) is the recombinant human-derived Angiopoietin-2 protein, expressed by HEK293 , with C-His labeled tag. The total length of Angiopoietin-2 Protein, Human (HEK293, His) is 478 a.a., with molecular weight of ~63.5 kDa.

Background

The Angiopoietin-2 (ANGPT2) protein binds to TEK/TIE2, competing for the ANGPT1 binding site and thereby modulating ANGPT1 signaling. This interaction can induce the tyrosine phosphorylation of TEK/TIE2 even in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2's action leads to the loosening of cell-matrix contacts, potentially inducing endothelial cell apoptosis and consequent vascular regression. However, in the presence of VEGF, ANGPT2 collaborates to facilitate endothelial cell migration and proliferation, acting as a permissive angiogenic signal. Furthermore, ANGPT2 is involved in the regulation of lymphangiogenesis. The protein also interacts with TEK/TIE2, competing for the same binding site as ANGPT1, and additionally interacts with ITGA5, contributing to its multifaceted role in angiogenesis and vascular regulation.

Biological Activity

Measured by its ability to bind recombinant human Tie2-His in a functional ELISA.

Species

Human

Source

HEK293

Tag

C-His

Accession

O15123 (Y19-F496)

Gene ID

285  [NCBI]

Molecular Construction
N-term
Angiopoietin-2 (Y19-F496)
Accession # O15123
His
C-term
Synonyms
Angiopoietin-2; ANG-2; ANGPT2
AA Sequence

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Weight

Approximately 63.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 2 mM MOPS, 15 mM NaCl, .5% CHAPS, pH 7.. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Angiopoietin-2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Angiopoietin-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P72829
Quantity:
MCE Japan Authorized Agent: