Neuropeptide Y (human) (free acid) 

Neuropeptide Y (human) free acid upregulates the adhesiveness of human endothelial cells for leukocytes. Neuropeptide Y belongs to the pancreatic polypeptide family, plays an important role in circadian rhythms, neurogenesis, and neuroprotection, nociception, feeding behavior, energy regulation, neuronal excitability, emotion, cognition, and stress response^[1][2].

Neuropeptide Y (human) free acid inhibits cyclic AMP accumulation in SK-N-MC cells stimulated by Isoproterenol (HY-B0468), Dopamine, Vasoactive intestinal peptide, Cholera toxin, and Forskolin (HY-15371)^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4272.67

C₁₈₉H₂₈₄N₅₄O₅₈S

99575-89-0

Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQ

O=C(N1[C@@H](CCC1)C(N[C@@H](CO)C(N[C@@H](CCCCN)C(N2[C@@H](CCC2)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(N)=O)C(N3[C@@H](CCC3)C(NCC(N[C@@H](CCC(O)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](C)C(N4[C@@H](CCC4)C(N[C@@H](C)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(O)=O)C(N[C@@H](CCSC)C(N[C@@H](C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC5=CC=C(C=C5)O)C(N[C@@H](CC6=CC=C(C=C6)O)C(N[C@@H](CO)C(N[C@@H](C)C(N[C@@H](CC(C)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC7=CNC=N7)C(N[C@@H](CC8=CC=C(C=C8)O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(N)=O)C(N[C@@H](CC(C)C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC9=CC=C(C=C9)O)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H](CC%10=CC=C(C=C%10)O)N

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Cajado et al. Neuropeptide Y family-degrading metallopeptidases in the Tityus serrulatus venom partially blocked by commercial antivenoms. Toxicol Sci. 2014 Dec;142(2):418-26.  [Content Brief]

  [2]. Sung CP, et al. Neuropeptide Y upregulates the adhesiveness of human endothelial cells for leukocytes. Circ Res. 1991 Jan;68(1):314-8.  [Content Brief]

  [3]. Gordon EA, et al. Characterization of functional neuropeptide Y receptors in a human neuroblastoma cell line. J Neurochem. 1990 Aug;55(2):506-13.  [Content Brief]