1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MIP-3 alpha/CCL20
  6. MIP-3 alpha/CCL20 Protein, Mouse

MIP-3 alpha/CCL20 Protein, Mouse

Cat. No.: HY-P7263
COA Handling Instructions

MIP-3 alpha/CCL20 Protein, Mouse is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Mouse  is a recombinant mouse CCL20 (A28-M97) expressed by E. coli.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $135 In-stock
50 μg $380 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MIP-3 alpha/CCL20 Protein, Mouse is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Mouse  is a recombinant mouse CCL20 (A28-M97) expressed by E. coli[1].

Background

CCL20, also known as macrophage inflammatory protein 3 alpha (MIP-3-alpha) and liver-activated regulatory chemokine (LARC), is a small cytokine belonging to the CC chemokine family and is located on chromosome 2 in the human genome. It is expressed at lower levels in the thymus, testis, prostate and intestine. CCL20 binds to and acts as a chemokine receptor CCR6 and synergistically inhibits the function of CD8 T cells with CCR6. CCL20 has antimicrobial activity and has been implicated in autoimmune diseases such as inflammatory bowel disease, rheumatoid arthritis, and psoriasis, as well as oncological diseases. It can induce Tregs to invade tumor tissue, recruit dendritic cells to promote immunosuppression, and induce endothelial cell proliferation and neointima formation[1][2].

In Vitro

CCL20 is preferentially released into the apical chamber in polarized BALB/c mouse uterine epithelial cells. In contrast, in rats, it is preferentially released into the basolateral compartment[3].

In Vivo

CCL20 (s.c., 0.5 μg in 100 μL 1×PBS, every week, 21 days or 28 days) recruits a large number of GFP+ Treg cells to the tumor, and the tumor size of the mice is also significantly increased compared to the PBS control in B6.Cg-Foxp3 tm2Tch/J mice[4].

Biological Activity

1.Full biological activity determined by a chemotaxis bioassay using human CCR6 transfected murine BaF3 cells is in a concentration range of 0.1-10 ng/ml.
2. Measured by its ability to chemoattract Huh-7 cells. The ED50 for this effect is ≤5.778 ng/mL, corresponding to a specific activity is ≥1.731×105 U/mg.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

O89093 (A28-M97)

Gene ID

20297  [NCBI]

Molecular Construction
N-term
CCL20 (A28-M97)
Accession # O89093
C-term
Synonyms
rMuMIP-3α/CCL20; C-C motif chemokine 20; MIP3A; SCYA20
AA Sequence

ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Molecular Weight

Approximately 8.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4 or PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MIP-3 alpha/CCL20 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIP-3 alpha/CCL20 Protein, Mouse
Cat. No.:
HY-P7263
Quantity:
MCE Japan Authorized Agent: