1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MIP-3 alpha/CCL20
  6. MIP-3 alpha/CCL20 Protein, Human (CHO)

MIP-3 alpha/CCL20 Protein, Human (CHO)

Cat. No.: HY-P7260
COA Handling Instructions

MIP-3 alpha/CCL20 Protein, Human (CHO) is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Human (CHO) is a recombinant human CCL20 (A27-M96) expressed by CHO cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $86 In-stock
50 μg $240 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE MIP-3 alpha/CCL20 Protein, Human (CHO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MIP-3 alpha/CCL20 Protein, Human (CHO) is a CC chemokine that attracts lymphocytes and mild neutrophils by binding to and acting on the chemokine receptor CCR6. It induces intracellular calcium mobilization and mediates cancer, various autoimmune diseases, and antimicrobial effects. MIP-3 alpha/CCL20 Protein, Human (CHO) is a recombinant human CCL20 (A27-M96) expressed by CHO cells[1].

Background

CCL20, also known as macrophage inflammatory protein 3 alpha (MIP-3-alpha) and liver-activated regulatory chemokine (LARC), is a small cytokine belonging to the CC chemokine family and is located on chromosome 2 in the human genome. It is expressed at lower levels in the thymus, testis, prostate and intestine. CCL20 binds to and acts as a chemokine receptor CCR6 and synergistically inhibits the function of CD8 T cells with CCR6. CCL20 has antimicrobial activity and has been implicated in autoimmune diseases such as inflammatory bowel disease, rheumatoid arthritis, and psoriasis, as well as oncological diseases. It can induce Tregs to invade tumor tissue, recruit dendritic cells to promote immunosuppression, and induce endothelial cell proliferation and neointima formation[1][2].

In Vitro

CCL20 (human, 0-50 μg/mL) inhibits B. abortus 2308 with the LD50 (the dose that achieves 50% reduction of CFU) > 50 μg/mL, effects on B. abortus RB51 in a dose-dependent manner with a LD50 of 8.7 μg/mL and demonstrates anti-E. coli activity with a LD50 of 1.5 μg/mL[3].
CCL20 is up-regulated in human colon adenocarcinoma cell lines stimulated by pro-inflammatory cytokines IL-1α and TNF-α and can function as an NF-κB target gene[4].

Biological Activity

The ED50 is <200 ng/mL as measured by CHO-K1/Gα15/hCCR6 cells (human Gα15 and human CCR6 stably expressed in CHO-K1 cells).

Species

Human

Source

CHO

Tag

Tag Free

Accession

P78556-1 (A27-M96)

Gene ID
Molecular Construction
N-term
CCL20 (A27-M96)
Accession # P78556-1
C-term
Synonyms
rHuMIP-3α/CCL20; C-C motif chemokine 20; MIP3A; SCYA20
AA Sequence

ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Molecular Weight

Approximately 8 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MIP-3 alpha/CCL20 Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIP-3 alpha/CCL20 Protein, Human (CHO)
Cat. No.:
HY-P7260
Quantity:
MCE Japan Authorized Agent: