1. Search Result
Search Result
Results for "

human monocytes

" in MedChemExpress (MCE) Product Catalog:

36

Inhibitors & Agonists

1

Biochemical Assay Reagents

11

Peptides

4

Natural
Products

2

Recombinant Proteins

5

Isotope-Labeled Compounds

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-148045

    Toll-like Receptor (TLR) Inflammation/Immunology
    TLR9-IN-1 is a potent and selective TLR9 inhibitor with an IC50 value of 7 nM for human TLR9. TLR9-IN-1 can be used for researching diseases associated with undesirable immune response .
    TLR9-IN-1
  • HY-P1117

    Formyl Peptide Receptor (FPR) Calcium Channel Neurological Disease Inflammation/Immunology
    MMK1 is a potent and selective human formyl peptide receptor like-1 (FPRL-1/FPR2) agonist with EC50s of <2 nM and >10000 nM for FPRL-1 and FPR1, respectively. MMK1 is a potent chemotactic and calcium-mobilizing agonist. MMK1 potently activates phagocytic leukocytes and enhances Pertussis Toxin (HY-112779)-sensitive production by human monocytes of proinflammatory cytokines IL-1b and IL-6. MMK1 exerts anxiolytic-like activity .
    MMK1
  • HY-P1117A

    Formyl Peptide Receptor (FPR) Calcium Channel Neurological Disease Inflammation/Immunology
    MMK1 TFA is a potent and selective human formyl peptide receptor like-1 (FPRL-1/FPR2) agonist with EC50s of <2 nM and >10000 nM for FPRL-1 and FPR1, respectively. MMK1 TFA is a potent chemotactic and calcium-mobilizing agonist. MMK1 TFA potently activates phagocytic leukocytes and enhances Pertussis Toxin (HY-112779)-sensitive production by human monocytes of proinflammatory cytokines IL-1b and IL-6. MMK1 TFA exerts anxiolytic-like activity .
    MMK1 TFA
  • HY-P2311

    Endogenous Metabolite Antibiotic
    Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.
    Defensin HNP-2 human
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Others
    Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .
    Met-RANTES (human)
  • HY-152581

    Cannabinoid Receptor Inflammation/Immunology
    CB2R antagonist 3 is a selective antagonist of cannabinoid type 2 receptor (CB2R). CB2R antagonist 3 has high affinity for human CB2R and specific selectivity for CB1R. CB2R antagonist 3 can be combined with CB65 (HY-110047), the activator of CB2R. CB2R antagonist 3 effectively up-regulates the expression of anti-inflammatory cytokines and down-regulates the expression of pro-inflammatory cytokines .
    CB2R antagonist 3
  • HY-76383

    Others Metabolic Disease Inflammation/Immunology
    LR-90 is an advanced glycation end product (AGE) inhibitor, inhibits inflammatory responses in human monocytes . LR-90 is also used in the research of diabetic animal model .
    LR-90
  • HY-B0253
    Piroxicam
    1 Publications Verification

    CP-16171

    COX Inflammation/Immunology Cancer
    Piroxicam (CP-16171) is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively.
    Piroxicam
  • HY-156850

    HDAC Cancer
    ITF 3756 is a potent and selective HDAC6 inhibitor. ITF 3756 reduces in vitro the expression of PD-L1 on human monocytes and on CD8 T cells, and shows anti-tumor activity .
    ITF 3756
  • HY-N11906

    Syringaresinol dimethyl ether; Lirioresinol C dimethyl ether

    Others Inflammation/Immunology
    Diayangambin (Syringaresinol dimethyl ether; Lirioresinol C dimethyl ether) is a cell proliferation inhibitor with an IC50 value of 1.5 μM against human monocytes. Diayangambin also has immunosuppressive and anti-inflammatory effects .
    Diayangambin
  • HY-108661

    P2Y Receptor Inflammation/Immunology
    NF546 is a selective non-nucleotide P2Y11 agonist with a pEC50 of 6.27. NF546 stimulates release of interleukin-8 from human monocyte-derived dendritic cells .
    NF546
  • HY-108661A

    P2Y Receptor Inflammation/Immunology
    NF546 (hydrate) is a selective non-nucleotide P2Y11 agonist with a pEC50 of 6.27. NF546 (hydrate) stimulates release of interleukin-8 from human monocyte-derived dendritic cells .
    NF546 hydrate
  • HY-139414
    Lysophosphatidylcholines
    1 Publications Verification

    Interleukin Related p38 MAPK ERK Apoptosis Inflammation/Immunology
    Lysophosphatidylcholines is an orally active lysolipid and a component of oxidized low density lipoprotein (LDL). Lysophosphatidylcholines induces cell injury, the production of IL-1β and apoptosis. Lysophosphatidylcholines has a proactive effect on sepsis .
    Lysophosphatidylcholines
  • HY-15450A

    CCR Endocrinology
    INCB 3284 is a potent, selective and orally bioavailable human CCR2 antagonist, inhibiting monocyte chemoattractant protein-1 binding to hCCR2, with an IC50 of 3.7 nM. INCB 3284 can be used in the research of acute liver failure.
    INCB 3284
  • HY-106228

    Fungal Bacterial Glutathione Peroxidase Infection
    HLF1-11, a human lactoferrin-derived peptide, is a broad spectrum antimicrobial agent. HLF1-11 inhibits human MPO activity. HLF1-11 also directs GM-CSF-driven monocyte differentiation toward macrophages, and enhances immune responses .
    HLF1-11
  • HY-B0253S

    CP-16171 d3

    COX Inflammation/Immunology Cancer
    Piroxicam-d3 is deuterium labeled Piroxicam. Piroxicam is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively [1].
    Piroxicam-d3
  • HY-15450

    CCR Endocrinology
    INCB 3284 dimesylate is a potent, selective and orally bioavailable human CCR2 antagonist, inhibiting monocyte chemoattractant protein-1 binding to hCCR2, with an IC50 of 3.7 nM. INCB 3284 dimesylate can be used in the research of acute liver failure.
    INCB 3284 dimesylate
  • HY-106409
    Tefinostat
    1 Publications Verification

    CHR-2845

    HDAC Apoptosis Cancer
    Tefinostat (CHR-2845) is a monocyte/macrophage targeted histone deacetylase (HDAC) inhibitor. Tefinostat can be cleaved into active acid CHR-2847 by the intracellular esterase human carboxylesterase-1 (hCE-1). Tefinostat can be used for the research of leukaemias .
    Tefinostat
  • HY-B0253S1

    CP-16171-d4

    Isotope-Labeled Compounds COX Inflammation/Immunology Cancer
    Piroxicam-d4 is the deuterium labeled Piroxicam. Piroxicam (CP-16171) is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively.
    Piroxicam-d4
  • HY-129905

    LLOMe hydrochloride; Leu-Leu methyl ester hydrochloride; H-Leu-Leu-OMe hydrochloride

    Endogenous Metabolite Inflammation/Immunology
    L-Leucyl-L-Leucine methyl ester (LLOMe) hydrochloride, a dipeptide condensation product of L-leucine methyl ester generated by human monocytes or polymorphonuclear leukocytes, selectively eliminates lymphocytes with cytotoxic potential. L-Leucyl-L-Leucine methyl ester hydrochloride also can induce endolysosomal pathway stress .
    L-Leucyl-L-Leucine methyl ester hydrochloride
  • HY-B0227S1

    RP-19583-d4

    COX Apoptosis Inflammation/Immunology
    Ketoprofen-d4 is the deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].
    Ketoprofen-d4
  • HY-B0227S

    RP-19583-d3

    COX Apoptosis Inflammation/Immunology
    Ketoprofen-d3 is the deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].
    Ketoprofen-d3
  • HY-129905A

    LLOMe hydrobromide; Leu-Leu methyl ester hydrobromide; H-Leu-Leu-OMe hydrobromide

    Endogenous Metabolite Inflammation/Immunology
    L-Leucyl-L-Leucine methyl ester (LLOMe) hydrobromide, a dipeptide condensation product of L-leucine methyl ester generated by human monocytes or polymorphonuclear leukocytes, selectively eliminates lymphocytes with cytotoxic potential. L-Leucyl-L-Leucine methyl ester hydrobromide also can induce endolysosomal pathway stress .
    L-Leucyl-L-Leucine methyl ester hydrobromide
  • HY-B0227S2

    RP-19583-13C,d3

    Isotope-Labeled Compounds COX Apoptosis Inflammation/Immunology
    Ketoprofen- 13C,d3 is the 13C- and deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].
    Ketoprofen-13C,d3
  • HY-P1846

    Notch Cancer
    Jagged-1 (188-204) is a fragment of the Jagged-1 (JAG-1) protein with Notch agonist activity. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM) cells. JAG-1 induces maturation of monocyte-derived human dendritic cells .
    Jagged-1 (188-204)
  • HY-101448

    WAY-171318

    MMP Apoptosis Inflammation/Immunology Cancer
    TMI-1 is a potent inhibitor of disintegrin metalloenzyme 17 (ADAM17) and other MMPs. TMI-1 inhibits LPS-induced TNF-α secretion in human primary monocytes, and human whole blood . TMI-1 selectively induces caspase-dependent apoptosis in triple negative (TN) and ERBB2-overexpressing breast tumor cell lines .
    TMI-1
  • HY-P1846A
    Jagged-1 (188-204) (TFA)
    5 Publications Verification

    Notch Cancer
    Jagged-1 (188-204) TFA is a fragment of the Jagged-1 (JAG-1) protein with Notch agonist activity. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM) cells. JAG-1 induces maturation of monocyte-derived human dendritic cells .
    Jagged-1 (188-204) (TFA)
  • HY-12511
    SKF-86002
    2 Publications Verification

    p38 MAPK Inflammation/Immunology
    SKF-86002 is an orally active p38 MAPK inhibitor, with anti-inflammatory, anti-arthritic and analgesic activities. SKF-86002 inhibits lipopolysaccharide (LPS)-stimulate human monocyte IL-1 and TNF-α production (IC50 = 1 μM). SKF-86002 inhibits lipoxygenase- and cyclooxygenase-mediated metabolism of arachidonic acid .
    SKF-86002
  • HY-108641

    p38 MAPK Inflammation/Immunology
    SKF-86002 dihydrochloride is an orally active p38 MAPK inhibitor, with anti-inflammatory, anti-arthritic and analgesic activities. SKF-86002 dihydrochloride inhibits lipopolysaccharide (LPS)-stimulate human monocyte IL-1 and TNF-α production (IC50 = 1 μM). SKF-86002 dihydrochloride inhibits lipoxygenase- and cyclooxygenase-mediated metabolism of arachidonic acid .
    SKF-86002 dihydrochloride
  • HY-128171
    Diflapolin
    1 Publications Verification

    FLAP Epoxide Hydrolase Inflammation/Immunology
    Diflapolin is a highly active dual 5-lipoxygenase-activating protein (FLAP)/soluble epoxide hydrolase (sEH) inhibitor with marked anti-inflammatory efficacy and high target selectivity. Diflapolin inhibits 5-LOX product formation in intact human monocytes and neutrophils with IC50s of  30 and 170 nM, respectively, and suppressed the activity of isolated sEH (IC50=20 nM) .
    Diflapolin
  • HY-163280

    NAMPT Neurological Disease
    JGB-1-155 is a positive allosteric modulators (N-PAMs), which enhances the activity of nicotinamide phosphoribosyltransferase NAMPT with EC50 of 3.29 μM. JGB-1-155 counteracts the oxidative stress, through upregulating the NAD + in THP-1 human monocytes. JGB-1-155 attenuates TNFα-induced ROS in HT-22 cells .
    JGB-1-155
  • HY-156622

    HMC-C-01-A; MBS2320

    Mitochondrial Metabolism Cancer
    Leramistat (HMC-C-01-A; MBS2320) is a mitochondrial complex 1 inhibitor, involving in cell metabolism immune metabolism regulation. Leramistat also inhibits ATP production in Thp1 human monocytes (IC50: 0.63 μM). Leramistat inhibits atopic dermatitis and other skin diseases autoimmune diseases, inflammatory diseases, cancer; and also inhibits osteoclast mediated disease .
    Leramistat
  • HY-151547

    P2X Receptor Neurological Disease
    MRS4719 is a potent P2X4 receptor antagonist with an IC50 value of 0.503 μM for human P2X4 receptor. MRS4719 can reduce infarct volume and reduce brain atrophy, showing neuroprotective and neuro-rehabilitative activities in ischemic stroke model. MRS4719 also reduces ATP-induced [Ca 2+]i influx in primary human monocyte-derived macrophages. MRS4719 can be used to research ischemic stroke .
    MRS4719
  • HY-P2358

    Toll-like Receptor (TLR) Inflammation/Immunology
    PSMα3 is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced maturation, inhibiting pro- and anti-inflammatory cytokine production and reducing antigen uptake. PSMα3 is an important toxin released by the most virulent strains of methicillin-resistant Staphylococcus aureus (MRSA) .
    PSMα3
  • HY-101188

    Histamine Receptor Infection
    INCB38579 is an orally active, highly brain penetrable, and selective histamine H4 receptor (HH4R) antagonist (hH4R IC50=4.8 nM, mH4R IC50=42 nM, rH4R IC50=32 nM). INCB38579 shows anti-inflammatory pain and anti-pruritic activities .
    INCB38579
  • HY-109014

    CMX-157

    HIV HBV Nucleoside Antimetabolite/Analog Infection
    Tenofovir exalidex (CMX157) is a lipid conjugate of the acyclic nucleotide analog Tenofovir with activity against both wild-type and antiretroviral drug-resistant HIV strains, including multidrug nucleoside/nucleotide analog-resistant viruses. Tenofovir exalidex is active against all major subtypes of HIV-1 and HIV-2 in fresh human PBMCs and against all HIV-1 strains evaluated in monocyte-derived macrophages, with EC50s ranging between 0.2 and 7.2 nM. CMX157 is orally available and has no apparent toxicity. Tenofovir exalidex also shows antiviral activity against HBV .
    Tenofovir exalidex

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: