1. Recombinant Proteins
  2. Others
  3. SCG3/Secretogranin-3 Protein, Human (449a.a, HEK293, His)

SCG3/Secretogranin-3 Protein, Human (449a.a, HEK293, His)

Cat. No.: HY-P71279
COA Handling Instructions

SCG3, a granin protein, regulates secretory granule formation and acts as a sorting receptor for intragranular proteins like CHGA. It interacts with SCG2 and CHGA, coordinating cellular processes. SCG3 also interacts with CPE, implying involvement in diverse cellular functions and regulatory pathways. Moreover, it may facilitate angiogenesis by promoting endothelial cell proliferation, migration, and tube formation via the MEK/ERK pathway. SCG3/Secretogranin-3 Protein, Human (449a.a, HEK293, His) is the recombinant human-derived SCG3/Secretogranin-3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $55 In-stock
50 μg $150 In-stock
500 μg $625 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SCG3, a granin protein, regulates secretory granule formation and acts as a sorting receptor for intragranular proteins like CHGA. It interacts with SCG2 and CHGA, coordinating cellular processes. SCG3 also interacts with CPE, implying involvement in diverse cellular functions and regulatory pathways. Moreover, it may facilitate angiogenesis by promoting endothelial cell proliferation, migration, and tube formation via the MEK/ERK pathway. SCG3/Secretogranin-3 Protein, Human (449a.a, HEK293, His) is the recombinant human-derived SCG3/Secretogranin-3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Secretogranin-3 (SCG3), a member of the granin protein family, actively regulates the biogenesis of secretory granules, acting as a sorting receptor for intragranular proteins, including chromogranin A (CHGA). Beyond its role in granule formation, SCG3 may participate in angiogenesis, exerting effects on endothelial cells by promoting proliferation, migration, and tube formation through the MEK/ERK signaling pathway. The protein interacts with CHGA and secretogranin II (SCG2), contributing to the orchestration of cellular processes. Additionally, SCG3 forms interactions, specifically through its C-terminus, with Carboxypeptidase E (CPE), suggesting a potential involvement in various cellular functions and regulatory pathways.

Biological Activity

Data is not available.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8WXD2-1 (F20-L468)

Gene ID
Molecular Construction
N-term
SCG3 (F20-L468)
Accession # Q8WXD2-1
6*His
C-term
Synonyms
Secretogranin-3; Secretogranin III; SgIII;
AA Sequence

FPKPGGSQDKSLHNRELSAERPLNEQIAEAEEDKIKKTYPPENKPGQSNYSFVDNLNLLKAITEKEKIEKERQSIRSSPLDNKLNVEDVDSTKNRKLIDDYDSTKSGLDHKFQDDPDGLHQLDGTPLTAEDIVHKIAARIYEENDRAVFDKIVSKLLNLGLITESQAHTLEDEVAEVLQKLISKEANNYEEDPNKPTSWTENQAGKIPEKVTPMAAIQDGLAKGENDETVSNTLTLTNGLERRTKTYSEDNFEELQYFPNFYALLKSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDEMIALQTKNKLEKNATDNISKLFPAPSEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNPGGKTDEPKGKTEAYLEAIRKNIEWLKKHDKKGNKEDYDLSKMRDFINKQADAYVEKGILDKEEAEAIKRIYSSL

Molecular Weight

Approximately 63.84 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SCG3/Secretogranin-3 Protein, Human (449a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SCG3/Secretogranin-3 Protein, Human (449a.a, HEK293, His)
Cat. No.:
HY-P71279
Quantity:
MCE Japan Authorized Agent: