1. Recombinant Proteins
  2. Others
  3. PSP94/MSMB Protein, Human (His)

PSP94/MSMB Protein, Human (His)

Cat. No.: HY-P79138
COA Handling Instructions

PSP94/MSMB protein forms homodimers and interacts with PI16. PSP94/MSMB Protein, Human (His) is the recombinant human-derived PSP94/MSMB protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $75 In-stock
10 μg $130 In-stock
50 μg $360 In-stock
100 μg $610 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PSP94/MSMB protein forms homodimers and interacts with PI16. PSP94/MSMB Protein, Human (His) is the recombinant human-derived PSP94/MSMB protein, expressed by E. coli , with C-His labeled tag.

Background

PSP94/MSMB protein forms a homodimer and interacts with PI16, highlighting its role in molecular interactions and potential functional significance within cellular processes.

Biological Activity

Measured by its ability to inhibit the proliferation of DU145 cells. The ED50 for this effect is 0.6869 ng/mL, corresponding to a specificactivity is 1.45×106 Unit/mg.

  • Measured by its ability to inhibit the proliferation of DU145 cells.The ED50 for this effect is 0.6869 ng/mL, corresponding to a specificactivity is 1.45×106 Unit/mg.
Species

Human

Source

E. coli

Tag

C-His

Accession

P08118-1 (S21-I114)

Gene ID
Molecular Construction
N-term
PSP94 (S21-I114)
Accession # P08118-1
His
C-term
Synonyms
Beta-microseminoprotein; MSMB; Immunoglobulin-binding factor; IGBF; PN44; Prostate secreted seminal plasma protein; Prostate secretory protein of 94 amino acids; PSP-94; PSP94; Seminal plasma beta-inhibin; PRSP; Prostate Secretory Protein of 94 Amino Acid
AA Sequence

SCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

Molecular Weight

Approximately 14 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PSP94/MSMB Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PSP94/MSMB Protein, Human (His)
Cat. No.:
HY-P79138
Quantity:
MCE Japan Authorized Agent: