1. Recombinant Proteins
  2. Others
  3. Progranulin/PGRN Protein, Human (HEK293, C-His)

Progranulin/PGRN Protein, Human (HEK293, C-His)

Cat. No.: HY-P74618A
COA Handling Instructions

EpCAM/TROP1 protein is a cell surface protein expressed in a variety of epithelial tissues. It plays a crucial role in cell adhesion, proliferation and differentiation. Progranulin/PGRN Protein, Human (HEK293, C-His) is the recombinant human-derived Progranulin/PGRN protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Progranulin/PGRN Protein, Human (HEK293, C-His) is 576 a.a., with molecular weight of 80-95 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $85 In-stock
10 μg $145 In-stock
50 μg $425 In-stock
100 μg $680 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EpCAM/TROP1 protein is a cell surface protein expressed in a variety of epithelial tissues. It plays a crucial role in cell adhesion, proliferation and differentiation. Progranulin/PGRN Protein, Human (HEK293, C-His) is the recombinant human-derived Progranulin/PGRN protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Progranulin/PGRN Protein, Human (HEK293, C-His) is 576 a.a., with molecular weight of 80-95 kDa.

Background

The Progranulin/PGRN Protein represents an 88 kDa precursor protein, also known as proepithelin and PC cell-derived growth factor, from which a family of secreted, glycosylated peptides called granulins is cleaved. This cleavage yields mature granulins, further processed into active 6 kDa peptides, including granulin A, granulin B, granulin C, and so forth. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. The granulin family, with its 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif, plays a crucial role in regulating cell growth, with various members acting as inhibitors, stimulators, or having dual actions on cell growth. Ubiquitously expressed, Progranulin/PGRN exhibits elevated levels in the bone marrow (RPKM 141.7), lung (RPKM 139.8), and 25 other tissues, emphasizing its potential significance in diverse physiological processes across multiple organs.

Biological Activity

1.Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.6157 μg/mL, corresponding to a specific activity is 1.62×103 U/mg.
2.Measured by its ability to inhibit THP-1 human acute monocyte migration in the presence of 10 ng/mL MCP-1.

  • Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.6157 μg/mL, corresponding to a specific activity is 1.62×103 U/mg.
Species

Human

Source

HEK293

Tag

C-10*His

Accession

NP_002078.1/P28799 (T18-L593)

Gene ID
Molecular Construction
N-term
PGRN (T18-L593)
Accession # NP_002078.1
10*His
C-term
Synonyms
Acrogranin; CLN11; GEP; GP88; Granulin; GRN; PCDGF; PEPI; PGRN; Proepithelin; Progranulin
AA Sequence

TRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL

Molecular Weight

Approximately 80-95 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 5 % trehalose, 5 % mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Progranulin/PGRN Protein, Human (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Progranulin/PGRN Protein, Human (HEK293, C-His)
Cat. No.:
HY-P74618A
Quantity:
MCE Japan Authorized Agent: