MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST)

MIP-3 alpha/CCL20 Protein, part of the intercrine beta (chemokine CC) family, is instrumental in regulating immune cell migration and inflammation. Recognized for attracting and activating dendritic cells and memory T cells, it plays a vital role in immune response at infection or inflammation sites. Operating via its receptor CCR6, MIP-3 alpha/CCL20 initiates events that enhance immune cell recruitment and activation. As a potential therapeutic target, it holds promise for immune response modulation and inflammation control in diverse pathological conditions. MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST) is the recombinant Rhesus Macaque-derived MIP-3 alpha/CCL20 protein, expressed by E. coli, with N-GST labeled tag. The total length of MIP-3 alpha/CCL20 Protein, Rhesus macaque (GST) is 70 a.a., with molecular weight of 35.1 kDa.

The MIP-3 alpha/CCL20 protein belongs to the intercrine beta (chemokine CC) family, a group of chemokines involved in the regulation of immune cell migration and inflammation. This protein is known for its role in attracting and activating immune cells, particularly dendritic cells and memory T cells, to sites of infection or inflammation. MIP-3 alpha/CCL20 functions through binding to its receptor, CCR6, and initiates a cascade of cellular events that promote immune cell recruitment and activation. It plays a crucial role in the immune response against pathogens and is also involved in the development of certain inflammatory diseases. MIP-3 alpha/CCL20 is considered as a potential therapeutic target for modulating immune responses and controlling inflammation in various pathological conditions.

Rhesus Macaque

E. coli

N-GST

Q8HYP6 (A27-M96)

574182  [NCBI]

ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM

35.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.