1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Leukemia Inhibitory Factor
  5. LIF Protein, Human

LIF Protein, Human

Cat. No.: HY-P7049
COA Handling Instructions

LIF Protein, Human is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $140 In-stock
50 μg $420 In-stock
100 μg $715 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

LIF Protein, Human is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

Background

Leukemia Inhibitory Factor has been shown to possess a remarkable variety of actions. It releases calcium from bone tissue, and is the differentiation inhibitory factor preventing spontaneous differentiation in normal embryonic stem cells[1]. Leukemia inhibitory factor (LIF) is a neuropoietic cytokine involved in both the neural and immune responses to injury. Its levels are increased in a variety of animal and human inflammatory conditions. Administration of Leukemia Inhibitory Factor can suppress inflammatory signs in some cases, for instance after intratracheal lipopolysaccharide-induced inflammation. Leukemia Inhibitory Factor also increases corticosterone levels via the hypothalamo-pituitary-adrenal axis. Other evidence suggests, that it can also act as a proinflammatory cytokine. Exogenously added Leukemia Inhibitory Factor induces acute phase protein expression and stimulates the production of proinflammatory cytokines and monocyte chemoattractants[2].

Biological Activity

1.The ED50 is <0.2 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >4.9 × 106 units/mg.
2.Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 25-204.1 pg/mL.

  • Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED ED50 for this effect is 0.1155 ng/mL, corresponding to a specific activity is 8.658×106units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P15018-1 (S23-F202)

Gene ID
Molecular Construction
N-term
LIF (S23-F202)
Accession # P15018-1
C-term
Synonyms
rHuLIF; Differentiation-stimulating Factor; D factor; MLPLI
AA Sequence

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Molecular Weight

Approximately 18-20 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LIF Protein, Human
Cat. No.:
HY-P7049
Quantity:
MCE Japan Authorized Agent: