1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. HEMK2 Protein, Human (His)

HEMK2 Protein, Human (His)

Cat. No.: HY-P77376
COA Handling Instructions

Contrary to the expected interaction, HEMK2 protein did not bind to TRMT112. This unique feature distinguishes HEMK2 from expected protein-protein interactions typically associated with its functional counterparts. HEMK2 Protein, Human (His) is the recombinant human-derived HEMK2 protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $50 In-stock
50 μg $130 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Contrary to the expected interaction, HEMK2 protein did not bind to TRMT112. This unique feature distinguishes HEMK2 from expected protein-protein interactions typically associated with its functional counterparts. HEMK2 Protein, Human (His) is the recombinant human-derived HEMK2 protein, expressed by E. coli , with C-His labeled tag.

Background

HEMK2 protein, based on available information, does not interact with TRMT112. TRMT112 is a protein known to form complexes with certain methyltransferases and influence their enzymatic activities. The absence of interaction between HEMK2 and TRMT112 suggests a unique molecular profile for HEMK2, distinct from other methyltransferases that may engage with TRMT112 for functional modulation. Understanding the specific protein-protein interactions and regulatory associations of HEMK2 is crucial for unraveling its role in cellular processes and potential contributions to biological pathways. Further research is needed to elucidate the precise functions and implications associated with HEMK2, particularly in the context of its distinct interaction patterns. (

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human HEMK2 is present at 10 μg/mL, can bind N6AMT1 Polyclonal antibody. The ED50 for this effect is 5.677 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q9Y5N5-2 (M1-S186)

Gene ID
Molecular Construction
N-term
HEMK2 (M1-S186)
Accession # Q9Y5N5-2
His
C-term
Synonyms
Methyltransferase N6AMT1; Lysine N-methyltransferase 9; N6AMT1; C21orf127; HEMK2; KMT9; PRED28
AA Sequence

MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Molecular Weight

Approximately 23 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HEMK2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HEMK2 Protein, Human (His)
Cat. No.:
HY-P77376
Quantity:
MCE Japan Authorized Agent: