CLEC14A Protein, Mouse (HEK293, His)

For research use only. We do not sell to patients.

Size	Price	Stock	Quantity
Free Sample		Apply now
5 μg	$60	In-stock	Estimated Time of Arrival: December 31
10 μg	$95	In-stock	Estimated Time of Arrival: December 31
50 μg	$250	In-stock	Estimated Time of Arrival: December 31
100 μg	$425	In-stock	Estimated Time of Arrival: December 31
> 100 μg		Get quote

* Please select Quantity before adding items.

Biological Activity	Measured by its binding ability in a functional ELISA. When Recombinant Mouse CLEC14A Protein is immobilized at 1 µg/mL (100 µL/well) can bind Mouse VEGF R3 Protein. The ED₅₀ for this effect is 1.61 μg/mL.
Species	Mouse
Source	HEK293
Tag	C-6*His
Accession	Q8VCP9 (M1-T386)
Gene ID	66864 [NCBI]
Molecular Construction	N-term CLEC14A (M1-T386) Accession # Q8VCP9 His C-term
Synonyms	C-type lectin domain family 14 member A; EGFR-5; C14orf27
AA Sequence	EHPTADRAACSASGACYSLHHATFKRRAAEEACSLRGGTLSTVHSGSEFQAVLLLLRAGPGPGGGSKDLLFWVALERSISQCTQEKEPLRGFSWLHPDSEDSEDSPLPWVEEPQRSCTVRKCAALQATRGVEPAGWKEMRCHLRTDGYLCKYQFEVLCPAPRPGAASNLSFQAPFRLSSSALDFSPPGTEVSAMCPGDLSVSSTCIQEETSAHWDGLFPGTVLCPCSGRYLLAGKCVELPDCLDHLGDFTCECAVGFELGKDGRSCETKVEEQLTLEGTKLPTRNVTATPAGAVTNRTWPGQVYDKPGEMPQVTEILQWGTQSTLPTIQKTPQTKPKVTGTPSGSVVLNYTSSPPVSLTFDTSST
Molecular Weight	Approximately 70-80 kDa due to the glycosylation.
Purity	Greater than 95% as determined by reducing SDS-PAGE
Appearance	Lyophilized powder.
Formulation	Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	N/A.
Storage & Stability	Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping	Shipping with dry ice.
Documentation	Select Batch: Data Sheet (236 KB) SDS (251 KB) COA (206 KB) Handling Instructions (2659 KB)

CLEC14A Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.