1. Recombinant Proteins
  2. Immune Checkpoint Proteins CAR-T Related Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. B7-H3 B7-H3/CD276
  5. CD276/B7-H3 Protein, Rat (HEK293, His)

CD276/B7-H3 Protein, Rat (HEK293, His)

Cat. No.: HY-P74314
Handling Instructions

CD276/B7-H3 Protein regulates T-cell-mediated immune responses and transplant rejection. It also promotes bone formation, functioning at the bone-immune interface. Additionally, it activates immune responses against tumors, eliminating them through natural killer cells and CD8 T-cells. Its interaction with TREML2 enhances T-cell activation, highlighting its role in immune regulation. CD276/B7-H3 Protein, Rat (HEK293, His) is the recombinant rat-derived CD276/B7-H3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD276/B7-H3 Protein regulates T-cell-mediated immune responses and transplant rejection. It also promotes bone formation, functioning at the bone-immune interface. Additionally, it activates immune responses against tumors, eliminating them through natural killer cells and CD8 T-cells. Its interaction with TREML2 enhances T-cell activation, highlighting its role in immune regulation. CD276/B7-H3 Protein, Rat (HEK293, His) is the recombinant rat-derived CD276/B7-H3 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD276/B7-H3, a multifaceted protein, exerts regulatory influence over T-cell-mediated immune responses and the progression of acute and chronic transplant rejection. Beyond its immunomodulatory role, it may contribute positively to bone formation, demonstrating a dual function at the bone-immune interface. Moreover, CD276 emerges as a key player in antitumor immunity by activating both acquired and innate immune responses, resulting in the elimination of tumor cells through natural killer cell and CD8 T-cell-dependent mechanisms. Notably, its interaction with TREML2 enhances T-cell activation, further underscoring its intricate involvement in immune regulation.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q7TPB4 (V29-F244)

Gene ID

315716  [NCBI]

Molecular Construction
N-term
CD276 (M1-F244)
Accession # Q7TPB4
His
C-term
Synonyms
B7H3; B7-H3B7 homolog 3; CD276; Costimulatory molecule
AA Sequence

VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLRQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGDMVTITCSSYQGYPEAEVFWKDGQGLPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTF

Molecular Weight

Approximately 34-43 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD276/B7-H3 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74314
Quantity:
MCE Japan Authorized Agent: