1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. CD19 B Cell CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins
  4. CD19 Protein, Mouse (HEK293, His)

CD19 Protein, Mouse (HEK293, His)

Cat. No.: HY-P74328
COA Handling Instructions

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca(2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD19 Protein, Mouse (HEK293, His) is 271 a.a., with molecular weight of ~51 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
50 μg $410 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca(2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD19 Protein, Mouse (HEK293, His) is 271 a.a., with molecular weight of ~51 kDa.

Background

CD19 protein functions as a coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes, effectively reducing the threshold for downstream signaling pathways and initiating B-cell responses to antigens. It activates signaling cascades leading to phosphatidylinositol 3-kinase activation and mobilization of intracellular Ca(2+) stores. While not essential for early B cell differentiation in the bone marrow, CD19 is crucial for the normal differentiation of B-1 cells and plays a vital role in B cell differentiation and proliferation in response to antigen challenges. Furthermore, CD19 is required for maintaining normal levels of serum immunoglobulins and the production of high-affinity antibodies upon antigen exposure. CD19 interacts with CR2/CD21 and forms a complex with CD81, CR2/CD21, CD81, and IFITM1/CD225 in the membrane of mature B-cells. It also interacts directly with CD81, essential for trafficking and compartmentalization of the CD19 receptor on the cell surface when phosphorylated on specific tyrosine residues. Additionally, CD19 interacts with PLCG2 when phosphorylated on Tyr-402 and with LYN, and it forms an interaction with the regulatory p85 subunit of phosphatidylinositol 3-kinase (PI3K) when tyrosine phosphorylated.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P25918 (G17-G287)

Gene ID

12478  [NCBI]

Molecular Construction
N-term
CD19 (G17-G287)
Accession # P25918
His
C-term
Synonyms
B-lymphocyte antigen CD19; CD19; B-lymphocyte surface antigen B4
AA Sequence

GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

Molecular Weight

Approximately 51 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD19 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74328
Quantity:
MCE Japan Authorized Agent: