CADM2/IGSF4D Protein, Human (HEK293, His)

CADM2/IGSF4D, functioning as an adhesion molecule, facilitates homo- and heterophilic interactions with nectin-like family members, promoting cell aggregation. This protein is crucial for synapse organization and regulated trans-synaptic adhesion, displaying a preference for binding to oligodendrocytes and highlighting its role in cellular interactions within the nervous system. CADM2/IGSF4D Protein, Human (HEK293, His) is the recombinant human-derived CADM2/IGSF4D protein, expressed by HEK293 , with C-His labeled tag. The total length of CADM2/IGSF4D Protein, Human (HEK293, His) is 306 a.a., with molecular weight of 40-57 kDa.

CADM2, also known as IGSF4D, serves as an adhesion molecule facilitating both homo- and heterophilic interactions with other members of the nectin-like family, thereby promoting cell aggregation. This protein holds significance in synapse organization, playing a crucial role in regulated trans-synaptic adhesion. Notably, CADM2 exhibits a preference for binding to oligodendrocytes, emphasizing its involvement in cellular interactions within the nervous system.

Measured in a cell proliferation assay using SH-SY5Y cells. The ED₅₀ for this effect is 1.052 μg/mL, corresponding to a specific activity is 950.570 units/mg.

Human

HEK293

C-6*His

Q8N3J6-2 (G30-D335)

253559  [NCBI]

GSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDPNALAGQNGPD

Approximately 40-57 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.