1. Recombinant Proteins
  2. Others
  3. BAMBI/NMA Protein, Human (HEK293, His)

BAMBI/NMA Protein, Human (HEK293, His)

Cat. No.: HY-P74392
Handling Instructions

BAMBI/NMA protein operates as a negative regulator, exerting inhibitory control over the TGF-beta signaling pathway. It finely tunes the signaling cascade initiated by TGF-beta, impacting cellular responses like proliferation, differentiation, and immune modulation. This regulatory role emphasizes BAMBI/NMA's significance in modulating diverse cellular behaviors, with potential implications in various physiological and pathological contexts. BAMBI/NMA Protein, Human (HEK293, His) is the recombinant human-derived BAMBI/NMA protein, expressed by HEK293 , with C-His labeled tag. The total length of BAMBI/NMA Protein, Human (HEK293, His) is 132 a.a., with molecular weight of 16-23 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

BAMBI/NMA Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BAMBI/NMA protein operates as a negative regulator, exerting inhibitory control over the TGF-beta signaling pathway. It finely tunes the signaling cascade initiated by TGF-beta, impacting cellular responses like proliferation, differentiation, and immune modulation. This regulatory role emphasizes BAMBI/NMA's significance in modulating diverse cellular behaviors, with potential implications in various physiological and pathological contexts. BAMBI/NMA Protein, Human (HEK293, His) is the recombinant human-derived BAMBI/NMA protein, expressed by HEK293 , with C-His labeled tag. The total length of BAMBI/NMA Protein, Human (HEK293, His) is 132 a.a., with molecular weight of 16-23 kDa.

Background

BAMBI/NMA protein serves as a negative regulator of TGF-beta signaling, exerting inhibitory control over this crucial cellular pathway. Its role involves tempering the signaling cascade initiated by TGF-beta, thereby influencing various cellular responses. By negatively regulating TGF-beta signaling, BAMBI/NMA contributes to the fine-tuned balance of this pathway, impacting processes such as cell proliferation, differentiation, and immune modulation. This regulatory function underscores the protein's significance in modulating cellular behaviors and highlights its potential implications in various physiological and pathological contexts.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q13145 (V21-A152)

Gene ID
Molecular Construction
N-term
BAMBI (V21-A152)
Accession # Q13145
His
C-term
Synonyms
BMP and activin membrane-bound inhibitor homolog; BAMBI; NMA
AA Sequence

VLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRA

Molecular Weight

Approximately 16-23 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BAMBI/NMA Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BAMBI/NMA Protein, Human (HEK293, His)
Cat. No.:
HY-P74392
Quantity:
MCE Japan Authorized Agent: