B7-H4 Protein, Rat (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag. The total length of B7-H4 Protein, Rat (HEK293, His) is 228 a.a., with molecular weight of 42-65 kDa.

B7-H4 protein functions as a negative regulator of T-cell-mediated immune responses by effectively suppressing T-cell activation, proliferation, cytokine production, and the development of cytotoxicity. Particularly noteworthy is its role when expressed on the cell surface of tumor macrophages, where it collaborates with regulatory T-cells (Treg) to suppress tumor-associated antigen-specific T-cell immunity. This dual action underscores its significance in creating an immunosuppressive microenvironment. Furthermore, B7-H4 is implicated in promoting epithelial cell transformation, suggesting its involvement in processes associated with altered cellular states and potential implications in the context of pathological conditions.

Measured by its ability to inhibit anti-CD3 antibody induced IL-2 secretion by human T cells. The ED₅₀ for this effect is 0.9752 μg/mL in the presence of 5μg/mL anti-CD3, corresponding to a specific activity is 1.025×10³ U/mg.

Rat

HEK293

C-6*His

Q501W4 (F29-S256)

295322  [NCBI]

FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

Approximately 42-65 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.