1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily Neurotrophic Factors
  4. Transforming Growth Factor-β TGF- β
  5. TGF-β2
  6. Animal-Free TGF beta 2/TGFB2 Protein, Human (His)

Animal-Free TGF beta 2/TGFB2 Protein, Human (His)

Cat. No.: HY-P700151AF
COA Handling Instructions

In the TGF-beta-2 pathway, the TGF beta 2/TGFB2 protein serves as a precursor to latency-associated peptide (LAP) and transforming growth factor beta-2 (TGF-beta-2), regulating their formation. Crucially, TGF-β2/TGFB2 maintains TGF-β-2 in a latent state within the extracellular matrix, forming a non-covalent association with TGF-β-2. Animal-Free TGF beta 2/TGFB2 Protein, Human (His) is the recombinant human-derived animal-FreeTGF beta 2/TGFB2 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free TGF beta 2/TGFB2 Protein, Human (His) is 112 a.a., with molecular weight of ~13.66 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $105 In-stock
10 μg $295 In-stock
50 μg $810 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

In the TGF-beta-2 pathway, the TGF beta 2/TGFB2 protein serves as a precursor to latency-associated peptide (LAP) and transforming growth factor beta-2 (TGF-beta-2), regulating their formation. Crucially, TGF-β2/TGFB2 maintains TGF-β-2 in a latent state within the extracellular matrix, forming a non-covalent association with TGF-β-2. Animal-Free TGF beta 2/TGFB2 Protein, Human (His) is the recombinant human-derived animal-FreeTGF beta 2/TGFB2 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free TGF beta 2/TGFB2 Protein, Human (His) is 112 a.a., with molecular weight of ~13.66 kDa.

Background

As a central player in the TGF-beta-2 signaling pathway, the TGF beta 2/TGFB2 protein assumes the role of a precursor for both the Latency-associated peptide (LAP) and the Transforming growth factor beta-2 (TGF-beta-2) chains. These chains collectively form the regulatory and active subunits of TGF-beta-2, respectively. Notably, TGF beta 2/TGFB2 is essential for maintaining the TGF-beta-2 chain in a latent state during storage within the extracellular matrix. The protein engages in non-covalent associations with TGF-beta-2, intricately regulating its activation through interactions with 'milieu molecules,' including LTBP1 and LRRC32/GARP. These interactions play a pivotal role in controlling the activation of TGF-beta-2, contributing to the finely tuned regulation of this critical signaling pathway.

Biological Activity

Measure by its ability to inhibit IL-4-induce proliferation in HT-2 cells. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human TGF beta 2 is >5 x 106 IU/mg.

Species

Human

Source

E. coli

Tag

C-His

Accession

P61812 (A303-S414)

Gene ID
Molecular Construction
N-term
TGFB2 (A303-S414)
Accession # P61812
His
C-term
Synonyms
G-TSF; LDS4; TGFB2
AA Sequence

MALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Molecular Weight

Approximately 13.66 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.01 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free TGF beta 2/TGFB2 Protein, Human (His)
Cat. No.:
HY-P700151AF
Quantity:
MCE Japan Authorized Agent: