1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily Neurotrophic Factors
  4. Transforming Growth Factor-β TGF- β
  5. TGF-β1
  6. Animal-Free TGF beta 1/TGFB1 Protein, Mouse (His)

Animal-Free TGF beta 1/TGFB1 Protein, Mouse (His)

Cat. No.: HY-P700227AF
COA Handling Instructions

In its proprotein form, the TGF beta-1/TGFB1 protein serves as a precursor to latency-associated peptide (LAP) and active transforming growth factor beta-1 (TGF-beta-1) chains. Critical to maintaining the latent state of TGF-β-1 within the extracellular matrix, preprotein interacts with “environmental molecules” such as LTBP1, LRRC32/GARP, and LRRC33/NRROS to regulate TGF-β-1 activation. Animal-Free TGF beta 1/TGFB1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTGF beta 1/TGFB1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free TGF beta 1/TGFB1 Protein, Mouse (His) is 112 a.a., with molecular weight of ~13.8 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $110 In-stock
10 μg $300 In-stock
50 μg $830 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

In its proprotein form, the TGF beta-1/TGFB1 protein serves as a precursor to latency-associated peptide (LAP) and active transforming growth factor beta-1 (TGF-beta-1) chains. Critical to maintaining the latent state of TGF-β-1 within the extracellular matrix, preprotein interacts with “environmental molecules” such as LTBP1, LRRC32/GARP, and LRRC33/NRROS to regulate TGF-β-1 activation. Animal-Free TGF beta 1/TGFB1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTGF beta 1/TGFB1 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free TGF beta 1/TGFB1 Protein, Mouse (His) is 112 a.a., with molecular weight of ~13.8 kDa.

Background

The TGF beta-1 (TGFB1) protein, in its proprotein form, serves as a precursor for both the Latency-associated peptide (LAP) and the active Transforming growth factor beta-1 (TGF-beta-1) chains. This proprotein is crucial for maintaining the TGF-beta-1 chain in a latent state during storage within the extracellular matrix. The interaction with various 'milieu molecules,' including LTBP1, LRRC32/GARP, and LRRC33/NRROS, plays a pivotal role in regulating the activation of TGF-beta-1. Specifically, LRRC33/NRROS is involved in the activation of TGF-beta-1 in macrophages and microglia, while LRRC32/GARP controls its activation on the surface of activated regulatory T-cells (Tregs). Additionally, the proprotein interacts with integrins (ITGAV:ITGB6 or ITGAV:ITGB8), leading to the distortion of the Latency-associated peptide chain and subsequent release of active TGF-beta-1.

Biological Activity

Measure by its ability to inhibit the IL-4 dependent proliferation in HT-2 cells.The ED50 for this effect is<0.1 ng/mL.

Species

Mouse

Source

E. coli

Tag

C-His

Accession

P04202 (A279-S390)

Gene ID
Molecular Construction
N-term
TGFB1 (A279-S390)
Accession # P04202
His
C-term
Synonyms
rMuTGF-beta 1/TGFB1; Transforming growth factor beta-1; TGF-β1; LAP
AA Sequence

MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Weight

Approximately 13.8 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 10 mM HCl.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free TGF beta 1/TGFB1 Protein, Mouse (His)
Cat. No.:
HY-P700227AF
Quantity:
MCE Japan Authorized Agent: