1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36 gamma
  6. Animal-Free IL-36 gamma/IL-1F9 Protein, Mouse (His)

Animal-Free IL-36 gamma/IL-1F9 Protein, Mouse (His)

Cat. No.: HY-P700211AF
COA Handling Instructions

IL-36 gamma/IL-1F9 protein activates NF-κB through IL1RL2 and promotes local inflammatory responses in the epithelial barrier. It affects keratinocytes, dendritic cells and T cells, promoting tissue infiltration, cell maturation and proliferation. Animal-Free IL-36 gamma/IL-1F9 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36 gamma/IL-1F9 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-36 gamma/IL-1F9 Protein, Mouse (His) is 152 a.a., with molecular weight of ~18.27 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $108 In-stock
10 μg $325 In-stock
50 μg $980 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-36 gamma/IL-1F9 protein activates NF-κB through IL1RL2 and promotes local inflammatory responses in the epithelial barrier. It affects keratinocytes, dendritic cells and T cells, promoting tissue infiltration, cell maturation and proliferation. Animal-Free IL-36 gamma/IL-1F9 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36 gamma/IL-1F9 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-36 gamma/IL-1F9 Protein, Mouse (His) is 152 a.a., with molecular weight of ~18.27 kDa.

Background

IL-36 gamma/IL-1F9 Protein acts as an agonist, activating NF-kappa B through the orphan IL-1-receptor-related protein 2/IL1RL2. As part of the IL-36 signaling system, it is believed to be present in epithelial barriers, contributing to local inflammatory responses, akin to the IL-1 system, sharing the coreceptor IL1RAP. This protein is implicated in skin inflammatory responses, influencing keratinocytes, dendritic cells, and, indirectly, T-cells to drive tissue infiltration, cell maturation, and proliferation. Additionally, it may play a role in pro-inflammatory responses during specific neutrophilic airway inflammations and contribute to the innate immune response against fungal pathogens. IL-36 gamma induces the production of various pro-inflammatory cytokines in bone marrow-derived dendritic cells (BMDCs) and enhances dendritic cell maturation by stimulating the surface expression of CD80, CD86, and MHC class II. Furthermore, it induces the production of IFN-gamma, IL-4, and IL-17 in cultured CD4(+) T-cells and splenocytes. The protein interacts with the cargo receptor TMED10, mediating translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion.

Biological Activity

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 gamma is >6 x104 IU/mg

Species

Mouse

Source

E. coli

Tag

C-His

Accession

Q8R460 (G13-S164)

Gene ID

215257  [NCBI]

Molecular Construction
N-term
IL-36γ (G13-S164)
Accession # Q8R460
His
C-term
Synonyms
Interleukin-36 gamma; IL-36γ; IL36G; IL-1F9; IL-1H1
AA Sequence

MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS

Molecular Weight

Approximately 18.27 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-36 gamma/IL-1F9 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-36 gamma/IL-1F9 Protein, Mouse (His)
Cat. No.:
HY-P700211AF
Quantity:
MCE Japan Authorized Agent: