1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. GRO-alpha
  6. Animal-Free GRO-alpha/CXCL1 Protein, Mouse (His)

Animal-Free GRO-alpha/CXCL1 Protein, Mouse (His)

Cat. No.: HY-P700167AF
COA Handling Instructions

GRO-alpha (CXCL1) Protein, with chemotactic properties, attracts and activates neutrophils during inflammatory responses. This hematoregulatory chemokine also suppresses hematopoietic progenitor cell proliferation, emphasizing its intricate role in hematopoiesis regulation. The truncated form KC(5-72) notably exhibits significantly enhanced hematopoietic activity in vitro. Animal-Free GRO-alpha/CXCL1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeGRO-alpha/CXCL1 protein, expressed by E. coli , with tag free. The total length of Animal-Free GRO-alpha/CXCL1 Protein, Mouse (His) is 68 a.a., with molecular weight of ~7.45 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $80 In-stock
10 μg $220 In-stock
50 μg $570 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GRO-alpha (CXCL1) Protein, with chemotactic properties, attracts and activates neutrophils during inflammatory responses. This hematoregulatory chemokine also suppresses hematopoietic progenitor cell proliferation, emphasizing its intricate role in hematopoiesis regulation. The truncated form KC(5-72) notably exhibits significantly enhanced hematopoietic activity in vitro. Animal-Free GRO-alpha/CXCL1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeGRO-alpha/CXCL1 protein, expressed by E. coli , with tag free. The total length of Animal-Free GRO-alpha/CXCL1 Protein, Mouse (His) is 68 a.a., with molecular weight of ~7.45 kDa.

Background

GRO-alpha (CXCL1) Protein exhibits chemotactic properties, attracting neutrophils and contributing to their activation during inflammatory responses. Additionally, this hematoregulatory chemokine displays the ability to suppress the proliferation of hematopoietic progenitor cells, highlighting its intricate role in regulating hematopoiesis. Notably, the truncated form KC(5-72) exhibits significantly enhanced hematopoietic activity in vitro.

Biological Activity

The ED50 is <15 ng/mL as measure by its ability to chemoattract BaF3 cells transfected with human CXCR2.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P12850 (N29-K96)

Gene ID

14825  [NCBI]

Molecular Construction
N-term
CXCL1 (N29-K96)
Accession # P12850
C-term
Synonyms
rMuGRO-α/CXCL1; Growth-regulated alpha protein; C-X-C motif chemokine 1; KC; HSF
AA Sequence

NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Molecular Weight

Approximately 7.45 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 10 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Animal-Free GRO-alpha/CXCL1 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free GRO-alpha/CXCL1 Protein, Mouse (His)
Cat. No.:
HY-P700167AF
Quantity:
MCE Japan Authorized Agent: