1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-10
  6. Animal-Free BMP-10 Protein, Human (His)

Animal-Free BMP-10 Protein, Human (His)

Cat. No.: HY-P700019AF
COA Handling Instructions

BMP-10 is essential for embryonic cardiomyocyte proliferation, preventing premature activation of CDKN1C/p57KIP and ensuring optimal expression of MEF2C and NKX2-5. As a ligand for AVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, it activates SMAD1, SMAD5 and SMAD8, regulating key signaling pathways. Animal-Free BMP-10 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-10 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-10 Protein, Human (His) is 108 a.a., with molecular weight of ~13.10 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $93 In-stock
10 μg $260 In-stock
50 μg $728 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BMP-10 is essential for embryonic cardiomyocyte proliferation, preventing premature activation of CDKN1C/p57KIP and ensuring optimal expression of MEF2C and NKX2-5. As a ligand for AVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, it activates SMAD1, SMAD5 and SMAD8, regulating key signaling pathways. Animal-Free BMP-10 Protein, Human (His) is the recombinant human-derived animal-FreeBMP-10 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free BMP-10 Protein, Human (His) is 108 a.a., with molecular weight of ~13.10 kDa.

Background

BMP-10 is vital for maintaining the proliferative activity of embryonic cardiomyocytes, preventing premature activation of the negative cell cycle regulator CDKN1C/p57KIP, and ensuring the necessary expression levels of cardiogenic factors like MEF2C and NKX2-5. Functioning as a ligand for ACVRL1/ALK1, BMPR1A/ALK3, and BMPR1B/ALK6, it triggers the activation of SMAD1, SMAD5, and SMAD8 transcription factors, orchestrating crucial signaling pathways. Additionally, BMP-10 exhibits inhibitory effects on endothelial cell migration and growth, and in breast cancer cell lines, it may attenuate both cell migration and cell matrix adhesion. Structurally, it forms a homodimer linked by disulfide bonds. Notably, BMP-10 interacts with extracellular matrix proteins FBN1 and FBN2 through its N-terminal domain and engages with ENG, further underscoring its multifaceted roles in various cellular processes.

Biological Activity

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is 1.7-2.1 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

O95393 (N317-R424)

Gene ID
Molecular Construction
N-term
BMP-10 (N317-R424)
Accession # O95393
His
C-term
Synonyms
Bone morphogenetic protein 10; BMP10
AA Sequence

MNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR

Molecular Weight

Approximately 13.10 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free BMP-10 Protein, Human (His)
Cat. No.:
HY-P700019AF
Quantity:
MCE Japan Authorized Agent: