1. Vitamin D Related/Nuclear Receptor
  2. Thyroid Hormone Receptor
  3. Parathyroid Hormone (1-34), bovine

Parathyroid Hormone (1-34), bovine 

Cat. No.: HY-P1252 Purity: 99.04%
COA Handling Instructions

Parathyroid Hormone (1-34), bovine is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Parathyroid Hormone (1-34), bovine Chemical Structure

Parathyroid Hormone (1-34), bovine Chemical Structure

CAS No. : 12583-68-5

Size Price Stock Quantity
1 mg USD 110 In-stock
5 mg USD 300 In-stock
10 mg USD 480 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Parathyroid Hormone (1-34), bovine:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Parathyroid Hormone (1-34), bovine

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Parathyroid Hormone (1-34), bovine is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis[1].

In Vitro

Parathyroid Hormone (1-34), bovine (0.1-100 ng/mL; 2-20 days) are added to the medium, it inhibits osteoblast proliferation in a dose-dependent manner. In another group, bPTH are added to the culture medium from day 1 to day 10, but not from days 11 to 20, a rebound of proliferation is observed in the PTH Day 1–10 group after bPTH withdrawal[1].
Parathyroid Hormone (1-34), bovine (0.1-100 ng/mL; 2-20 days) induces diverse effects on the calcium and phosphorus content of culture medium. The calcium and phosphorus content of culture medium in the PTH-C 100 ng/mL group are higher than in teh control group[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Proliferation Assay[1]

Cell Line: MC3T3-E1 cells
Concentration: 0.1-100 ng/mL
Incubation Time: 2-20 days
Result: Resulted a decrease of osteoblast proliferationin concentration-dependent manner.
Resulted in a rebound of proliferation when PTH withdrawal.
In Vivo

Parathyroid Hormone (1-34)(subcutaneous injection; 80 μg/kg; 5 days) increases serum osteocalcin concentrations without changing serum inorganic phosphate or calcium concentrations in either group of old animals. Serum 1,25-dihydroxyvitamin D concentrations are significantly higher in the PTH-treated senile female rats than the sex-matchedvehicle-treated controls[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4108.77

Formula

C183H288N54O50S2

CAS No.
Unlabeled CAS

Appearance

Solid

Color

White to off-white

Sequence Shortening

AVSEIQFMHNGKHLSSMERVEWLRKKLQDVHNF

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

H2O : 50 mg/mL (12.17 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2434 mL 1.2169 mL 2.4338 mL
5 mM 0.0487 mL 0.2434 mL 0.4868 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2434 mL 1.2169 mL 2.4338 mL 6.0845 mL
5 mM 0.0487 mL 0.2434 mL 0.4868 mL 1.2169 mL
10 mM 0.0243 mL 0.1217 mL 0.2434 mL 0.6085 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Parathyroid Hormone (1-34), bovine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Parathyroid Hormone (1-34), bovine
Cat. No.:
HY-P1252
Quantity:
MCE Japan Authorized Agent: