1. Induced Disease Models Products Neuronal Signaling
  2. Nervous System Disease Models Amyloid-β
  3. Alzheimer's Disease Models
  4. β-Amyloid (42-1), human

β-Amyloid (42-1), human  (Synonyms: Amyloid β Peptide (42-1)(human))

Cat. No.: HY-P1362 Purity: 96.47%
COA Handling Instructions

β-Amyloid (42-1), human is the inactive form of Amyloid β Peptide (1-42). β-Amyloid (42-1), human is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Amyloid (42-1), human Chemical Structure

β-Amyloid (42-1), human Chemical Structure

CAS No. : 317366-82-8

Size Price Stock Quantity
1 mg USD 295 In-stock
5 mg USD 660 In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of β-Amyloid (42-1), human:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Amyloid (42-1), human is the inactive form of Amyloid β Peptide (1-42). β-Amyloid (42-1), human is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease[1].

In Vivo

β-Amyloid (42-1), human can be used in animal modeling to construct Alzheimer's disease model.

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4514.04

Formula

C203H311N55O60S

CAS No.
Unlabeled Cas

Appearance

Solid

Color

White to off-white

Sequence

Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp

Sequence Shortening

AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*The compound is unstable in solutions, freshly prepared is recommended.

Solvent & Solubility
In Vitro: 

DMSO : 100 mg/mL (22.15 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2215 mL 1.1077 mL 2.2153 mL
5 mM 0.0443 mL 0.2215 mL 0.4431 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation

Purity: 96.72%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. The compound is unstable in solutions, freshly prepared is recommended.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
DMSO 1 mM 0.2215 mL 1.1077 mL 2.2153 mL 5.5383 mL
5 mM 0.0443 mL 0.2215 mL 0.4431 mL 1.1077 mL
10 mM 0.0222 mL 0.1108 mL 0.2215 mL 0.5538 mL
15 mM 0.0148 mL 0.0738 mL 0.1477 mL 0.3692 mL
20 mM 0.0111 mL 0.0554 mL 0.1108 mL 0.2769 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Amyloid (42-1), human
Cat. No.:
HY-P1362
Quantity:
MCE Japan Authorized Agent: