1. GPCR/G Protein Neuronal Signaling
  2. CGRP Receptor
  3. Adrenomedullin (1-50), rat

Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adrenomedullin (1-50), rat Chemical Structure

Adrenomedullin (1-50), rat Chemical Structure

Size Price Stock Quantity
500 μg USD 250 In-stock
1 mg USD 350 In-stock
5 mg USD 1200 In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor.

IC50 & Target

CGRP1 receptor[1]

In Vitro

Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Adrenomedullin (1-50), rat causes a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature, and this effect is inhibited by CGRP1 receptor antagonist. Adrenomedullin (1-50), rat activates CGRP1 receptor in the double-perfused mesenteric bed of the rat[1]. Adrenomedullin (1-50) ameliorates pulmonary vascular structural remodeling of hypoxic rats with incresed plasma NO and H(2)S concentrations. Adrenomedullin (1-50) also regulates the development of hypoxic pulmonary hypertension and hypoxic pulmonary vascular structural remodeling, through promoting NO and H(2)S production in hypoxic rats[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

5729.50

Formula

C242H381N77O75S5

Unlabeled CAS

Appearance

Solid

Color

White to off-white

Sequence

Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19)

Sequence Shortening

YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: Cys14-Cys19)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Purity & Documentation

Purity: 99.90%

References
Animal Administration
[1]

Rats[1]
Male albino Wistar rats (250-350 g) are used in the assay. Following an equilibration period of 45 min, the vasoactive effect of Adrenomedullin (1-50), rat, rADM (11-50), acetylcholine (ACh), and bradykinin (BK) is evaluated. The perfusion pressure on both sides of the mesenteric circulation is increased by infusing either a sympathomimetic, methoxamine (100 μM), on the arterial side or a thromboxomimetic, U46619 (0.5 μM), on the venous side. When a plateau is reached, the agents (Adrenomedullin (1-50), rat, etc.) are administered by bolus injections (1 to 45 μL). Vasodilator responses are expressed as percent reduction of induced tone on both sides of the mesenteric vasculature. In some experiments, the effects of the CGRP1 receptor antagonist hCGRP8-37 and of the nitric oxide synthase inhibitor L-NAME are evaluated. They are infused 15 and 30 min, respectively, before the administration of the agonists[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Adrenomedullin (1-50), rat Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adrenomedullin (1-50), rat
Cat. No.:
HY-P1534
Quantity:
MCE Japan Authorized Agent: